PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Vang09g01920.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna
Family MYB_related
Protein Properties Length: 399aa    MW: 44772.7 Da    PI: 6.51
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Vang09g01920.1genomeSNUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding53.94.1e-173582148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+ Ed +lv++vk++G g+W+++ +  g+ R++k+c++rw ++l
   Vang09g01920.1 35 KGPWTPSEDAILVEYVKKHGEGNWNSVHKNSGLFRCGKSCRLRWANHL 82
                     79******************************************9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129422.8133086IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.0E-213188IPR009057Homeodomain-like
SMARTSM007176.4E-153484IPR001005SANT/Myb domain
SuperFamilySSF466897.81E-2035121IPR009057Homeodomain-like
PfamPF002492.1E-153582IPR001005SANT/Myb domain
CDDcd001673.22E-123782No hitNo description
Gene3DG3DSA:1.10.10.607.5E-6104121IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 399 aa     Download sequence    Send to blast
MARTVSNNDI TNDETGDDSN ATTKEEGEVK GRVRKGPWTP SEDAILVEYV KKHGEGNWNS  60
VHKNSGLFRC GKSCRLRWAN HLRPNLKKVQ PFSFFGFGSE HPLLPGRTDN EIKNFWNTRM  120
KRRQRAGLPI YPPELHAEAT AFNLQHRYLE DIPHSSFALL LSSCYPKKLD DPSQTNGFNA  180
NPLQNHPDSA NFYINPCLKH FKFSNDNGGS TNLALPLSPL SQYGSSSSTL LNHSFGDHGI  240
ISGSPYESFP LAQGLSHNNK SKNEEDPTLA GKLSCKRKNM EYADEGRTEP MVSAMKKNSS  300
NCTTTENQRD DDNSFSQLSK GKKVMREDPM EEMNSMDDDL FSLLNQFPLE TPMPEWYRRG  360
ESQSLGLENQ PNASPPDPAD QEYAWTLGTC WNNMPSIC*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A1e-15351237107B-MYB
1h8a_C1e-153312325127MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150400.0AP015040.1 Vigna angularis var. angularis DNA, chromosome 7, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014499553.10.0PREDICTED: transcription factor GAMYB-like
TrEMBLA0A0L9UMU60.0A0A0L9UMU6_PHAAN; Uncharacterized protein
TrEMBLA0A0S3SH080.0A0A0S3SH08_PHAAN; Uncharacterized protein
STRINGGLYMA13G38521.11e-158(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF99493240
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G06100.12e-48myb domain protein 33